PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g12270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 244aa    MW: 27141.5 Da    PI: 9.8453
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g12270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA95.75.3e-30111167158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy+rIl+RRq+Rak+e ekk  +ksrkpylheSRh+hAlrR+R+sgGrF
  CA11g12270 111 QEPVYVNAKQYRRILQRRQSRAKAELEKKQ-IKSRKPYLHESRHQHALRRARASGGRF 167
                 69************************9999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-32109170IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.166110170IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-25112167IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.0E-23113135IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.0E-23144167IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MSMEKRKCKP CLYYFLSGIA LEDIFSRSDG SYGKVDQNFQ PAAPAIPPRL DGSLAQPQQL  60
ELVGHSIACA PIPYVDPYYG GMMTAFGQPL VPPHVLDMHY ARMPLPQEMA QEPVYVNAKQ  120
YRRILQRRQS RAKAELEKKQ IKSRKPYLHE SRHQHALRRA RASGGRFAKK TDASKGTGSV  180
SSSGSEALQF NAADIQRRHE SGRLADLQHS YSNGSSYGNQ SSFQESKDEY QSAESREGGF  240
PGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-17111167258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0141460.0BT014146.1 Lycopersicon esculentum clone 133265F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016547792.11e-162PREDICTED: nuclear transcription factor Y subunit A-1 isoform X1
SwissprotQ9LXV56e-48NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0V0IR831e-139A0A0V0IR83_SOLCH; Putative nuclear transcription factor Y subunit A-1-like
STRINGPGSC0003DMT4000189581e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.44e-47nuclear factor Y, subunit A1